Return to main results Retrieve Phyre Job Id

Job DescriptionP08394
Confidence70.83%DateThu Jan 5 11:01:26 GMT 2012
Rank390Aligned Residues29
% Identity21%Templatec2ak3B_
PDB info PDB header:transferase (phosphotransferase)Chain: B: PDB Molecule:adenylate kinase isoenzyme-3; PDBTitle: the three-dimensional structure of the complex between2 mitochondrial matrix adenylate kinase and its substrate3 amp at 1.85 angstroms resolution
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40
Predicted Secondary structure 

















Query SS confidence 





































Query Sequence  DVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRL
Query Conservation       
     

 
  

 







 

  
  

Alig confidence 







.........




















Template Conservation         
......... 
 
  







  

  
Template Sequence  ASARLLRA. . . . . . . . . AIMGAPGSGKGTVSSRITKHF
Template Known Secondary structure 





.........

TTSSB
Template Predicted Secondary structure 




.........






Template SS confidence 





































   1....... .10.........20.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions