Return to main results Retrieve Phyre Job Id

Job DescriptionP63183
Confidence5.37%DateThu Jan 5 12:07:53 GMT 2012
Rank43Aligned Residues40
% Identity18%Templatec3c66B_
PDB info PDB header:transferaseChain: B: PDB Molecule:poly(a) polymerase; PDBTitle: yeast poly(a) polymerase in complex with fip1 residues 80-105
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   338.340.........350.........360.........370.........380.........390...
Predicted Secondary structure 






Query SS confidence 























































Query Sequence  YIPFVNWMLYVAVVIVIVSFEHSSNLAAAYGIAVTGTMVLTSILSTTVARQNWHWN
Query Conservation 


 

 

 

 
 

  
  
  
  



 
  

 


 
        
   
Alig confidence 



























................











Template Conservation 




 










 
      

 ................ 

  

 
 
 
Template Sequence  FPGGVAWAMLVARICQLYPNACSAVILN. . . . . . . . . . . . . . . . RFFIILSEWNWP
Template Known Secondary structure  S


TT

................S
TT
Template Predicted Secondary structure 







................




Template SS confidence 























































   230.........240.........250....... ..260.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions