Return to main results Retrieve Phyre Job Id

Job DescriptionP00962
Confidence21.51%DateThu Jan 5 10:57:24 GMT 2012
Rank120Aligned Residues29
% Identity38%Templated1hbna2
SCOP infoFerredoxin-like Methyl-coenzyme M reductase subunits Methyl-coenzyme M reductase alpha and beta chain N-terminal domain
Resolution1.16

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   286...290....... ..300. ........310....
Predicted Secondary structure 







........

..


Query SS confidence 











. . . . . . . .



. .












Query Sequence  WDDPRMPTISGL. . . . . . . . RRRG. . YTAASIREFCKRI
Query Conservation 




  

 

........



..  



  
    
Alig confidence 











........



..












Template Conservation 






 




 

  





 






 



 
Template Sequence  WDDIRRTVIVGLNHAHAVIEKRLGKEVTPETITHYLETV
Template Known Secondary structure  TSTS




Template Predicted Secondary structure 




Template SS confidence 






































   98.100.........110.........120.........130......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions