Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence56.75%DateThu Jan 5 10:59:52 GMT 2012
Rank84Aligned Residues30
% Identity30%Templated2afhe1
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nitrogenase iron protein-like
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40. ........50........
Predicted Secondary structure 


















.....



Query SS confidence 








































. . . . .
















Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGG. . . . . INVARAIAHLGGSATAI
Query Conservation 
  
     
  

                       

  ..... 


  
  

  
  
Alig confidence 







............................




.....
















Template Conservation 

 


 
............................









 


  

  
 




Template Sequence  MRQCAIYG. . . . . . . . . . . . . . . . . . . . . . . . . . . . KGGIGKSTTTQNLVAALAEMGKKVMIV
Template Known Secondary structure 
............................
TTSSTT

Template Predicted Secondary structure 


............................








Template SS confidence 






























































   2....... 10.........20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions