Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence45.99%DateThu Jan 5 10:59:52 GMT 2012
Rank97Aligned Residues32
% Identity25%Templatec3rfxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:uronate dehydrogenase; PDBTitle: crystal structure of uronate dehydrogenase from agrobacterium2 tumefaciens, y136a mutant complexed with nad
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........
Predicted Secondary structure 






















Query SS confidence 


























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIF
Query Conservation 
  
     
  

                       

   


  
  

  
  
 
Alig confidence 








...........................






















Template Conservation 

 





...........................

 

  
   
   
  
    
Template Sequence  MKRLLVTGA. . . . . . . . . . . . . . . . . . . . . . . . . . . AGQLGRVMRERLAPMAEILRLAD
Template Known Secondary structure  ST...........................TSTGGG
Template Predicted Secondary structure 



...........................




Template SS confidence 


























































   3......10. ........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions