Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence33.46%DateThu Jan 5 10:59:52 GMT 2012
Rank124Aligned Residues30
% Identity13%Templatec3qj4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:renalase; PDBTitle: crystal structure of human renalase (isoform 1)
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.. ......
Predicted Secondary structure 




















..

Query SS confidence 



















































. .





Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLG. . GSATAI
Query Conservation 
  
     
  

                       

   


  
  

..  
  
Alig confidence 










............................












..





Template Conservation 
 

 




 ............................


  
  
   
    
 
 
Template Sequence  MAQVLIVGAGM. . . . . . . . . . . . . . . . . . . . . . . . . . . . TGSLCAALLRRQTGPLYLAVW
Template Known Secondary structure 


S............................S



Template Predicted Secondary structure 





............................




Template SS confidence 



























































   1........10. ........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions