Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence40.63%DateThu Jan 5 10:59:52 GMT 2012
Rank106Aligned Residues34
% Identity29%Templatec3p19A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:putative blue fluorescent protein; PDBTitle: improved nadph-dependent blue fluorescent protein
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 






















Query SS confidence 



























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
Query Conservation 
  
     
  

                       

   


  
  

  
  
  
Alig confidence 









..........................























Template Conservation 
 







..........................
 


 


  

  

 

   
Template Sequence  MKKLVVITGA. . . . . . . . . . . . . . . . . . . . . . . . . . SSGIGEAIARRFSEEGHPLLLLAR
Template Known Secondary structure 


ST..........................TSTT

S
Template Predicted Secondary structure 



..........................





Template SS confidence 



























































   1........10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions