Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence62.06%DateThu Jan 5 10:59:52 GMT 2012
Rank78Aligned Residues30
% Identity37%Templatec3kpgA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:sulfide-quinone reductase, putative; PDBTitle: crystal structure of sulfide:quinone oxidoreductase from2 acidithiobacillus ferrooxidans in complex with decylubiquinone
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50. .......
Predicted Secondary structure 



















...


Query SS confidence 


















































. . .






Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHL. . . GGSATAI
Query Conservation 
  
     
  

                       

   


  
  
...
  
  
Alig confidence 







............................














...






Template Conservation 

 




............................

 


 

  
      
  



Template Sequence  MAHVVILG. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGTGGMPAAYEMKEALGSGHEVTLI
Template Known Secondary structure 


............................
STT
TTS
Template Predicted Secondary structure 


............................







Template SS confidence 




























































   1....... .10.........20.........30...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions