Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence71.72%DateThu Jan 5 10:59:52 GMT 2012
Rank73Aligned Residues30
% Identity17%Templatec3kd9B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:coenzyme a disulfide reductase; PDBTitle: crystal structure of pyridine nucleotide disulfide oxidoreductase from2 pyrococcus horikoshii
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50. .......
Predicted Secondary structure 



















..


Query SS confidence 


















































. .






Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHL. . GGSATAI
Query Conservation 
  
     
  

                       

   


  
  
..
  
  
Alig confidence 







............................














..






Template Conservation 







............................

 


 

  
        
 

Template Sequence  LKKVVIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAAGMSAASRVKRLKPEWDVKVF
Template Known Secondary structure 


............................
S
TTS
Template Predicted Secondary structure 


............................





Template SS confidence 



























































   3......10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions