Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence29.96%DateThu Jan 5 10:59:52 GMT 2012
Rank133Aligned Residues49
% Identity16%Templatec3ia7A_
PDB info PDB header:transferaseChain: A: PDB Molecule:calg4; PDBTitle: crystal structure of calg4, the calicheamicin glycosyltransferase
Resolution1.91 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40. ........50.........60.........70.....
Predicted Secondary structure 


















.....






Query SS confidence 








































. . . . .

































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGG. . . . . INVARAIAHLGGSATAIFPAGGATGEHLVSLLAD
Query Conservation 
  
     
  

                       

  ..... 


  
  

  
  
  

 
 
  
   
  
Alig confidence 







............................




.....

















......









Template Conservation     

   ............................    

      

  
   

 
 
 
......          
Template Sequence  QRHILFAN. . . . . . . . . . . . . . . . . . . . . . . . . . . . VQGHGHVYPSLGLVSELARRGHRITYVT. . . . . . TPLFADEVKA
Template Known Secondary structure 


............................
SSTT
......
Template Predicted Secondary structure 


............................






......
Template SS confidence 















































































   3......10 .........20.........30........ .40........
 
   76...80...
Predicted Secondary structure 



Query SS confidence 







Query Sequence  ENVPVATV
Query Conservation   

    
Alig confidence 







Template Conservation   
      
Template Sequence  AGAEVVLY
Template Known Secondary structure  TT

Template Predicted Secondary structure 



Template SS confidence 







   4950......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions