Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence40.19%DateThu Jan 5 10:59:52 GMT 2012
Rank109Aligned Residues30
% Identity37%Templatec3i3lA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:alkylhalidase cmls; PDBTitle: crystal structure of cmls, a flavin-dependent halogenase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50........
Predicted Secondary structure 

..




















Query SS confidence 


. .






















































Query Sequence  MVR. . IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  ..
     
  

                       

   


  
  

  
  
Alig confidence 


..







............................


















Template Conservation 
   








............................


 

  


 

 
 

Template Sequence  MTRSKVAIIGGGP. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGSVAGLTLHKLGHDVTIY
Template Known Secondary structure 





S............................TT
Template Predicted Secondary structure 






............................


Template SS confidence 



























































   1........10... ......20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions