Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence30.00%DateThu Jan 5 10:59:52 GMT 2012
Rank132Aligned Residues29
% Identity21%Templatec3gucB_
PDB info PDB header:transferaseChain: B: PDB Molecule:ubiquitin-like modifier-activating enzyme 5; PDBTitle: human ubiquitin-activating enzyme 5 in complex with amppnp
Resolution2.25 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50........
Predicted Secondary structure 





















Query SS confidence 
























































Query Sequence  VRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation    
     
  

                       

   


  
  

  
  
Alig confidence 






............................





















Template Conservation    




............................ 




 

  

  


 
 
Template Sequence  FAVAIVG. . . . . . . . . . . . . . . . . . . . . . . . . . . . VGGVGSVTAEMLTRCGIGKLLL
Template Known Secondary structure 

............................
STTT
S
Template Predicted Secondary structure 
............................




Template SS confidence 
























































   74.....80 .........90.........100..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions