Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence28.61%DateThu Jan 5 10:59:52 GMT 2012
Rank141Aligned Residues32
% Identity25%Templatec3gpiA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:nad-dependent epimerase/dehydratase; PDBTitle: structure of putative nad-dependent epimerase/dehydratase2 from methylobacillus flagellatus
Resolution1.44 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 






















Query SS confidence 



























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
Query Conservation 
  
     
  

                       

   


  
  

  
  
  
Alig confidence 







............................























Template Conservation 







............................




  
   
   
  
    
Template Sequence  LSKILIAG. . . . . . . . . . . . . . . . . . . . . . . . . . . . CGDLGLELARRLTAQGHEVTGLRR
Template Known Secondary structure 



............................
STT


Template Predicted Secondary structure 


............................





Template SS confidence 



























































   1....... .10.........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions