Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence38.28%DateThu Jan 5 10:59:52 GMT 2012
Rank114Aligned Residues30
% Identity23%Templatec3ghyA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:ketopantoate reductase protein; PDBTitle: crystal structure of a putative ketopantoate reductase from ralstonia2 solanacearum molk2
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50........
Predicted Secondary structure 






















Query SS confidence 

























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  
     
  

                       

   


  
  

  
  
Alig confidence 







............................





















Template Conservation 



 


............................ 
  
   
  
   
  
   
Template Sequence  LTRICIVG. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGAVGGYLGARLALAGEAINVL
Template Known Secondary structure 


S............................

TT

Template Predicted Secondary structure 


............................




Template SS confidence 

























































   1....... .10.........20.........30
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions