Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence59.20%DateThu Jan 5 10:59:52 GMT 2012
Rank79Aligned Residues30
% Identity23%Templatec3d8xB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:thioredoxin reductase 1; PDBTitle: crystal structure of saccharomyces cerevisiae nadph dependent2 thioredoxin reductase 1
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50........
Predicted Secondary structure 

.




















Query SS confidence 


.






















































Query Sequence  MVR. IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  .
     
  

                       

   


  
  

  
  
Alig confidence 


.







............................


















Template Conservation 
  







 ............................


 

  
   
  
 

Template Sequence  VHNKVTIIGSGP. . . . . . . . . . . . . . . . . . . . . . . . . . . . AAHTAAIYLARAEIKPILY
Template Known Secondary structure 


S............................TT


Template Predicted Secondary structure 






............................



Template SS confidence 


























































   2.......10... ......20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions