Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence34.81%DateThu Jan 5 10:59:52 GMT 2012
Rank120Aligned Residues29
% Identity21%Templatec3allA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase; PDBTitle: crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid2 oxygenase, mutant y270a
Resolution1.78 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50........
Predicted Secondary structure 





















Query SS confidence 
























































Query Sequence  VRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation    
     
  

                       

   


  
  

  
  
Alig confidence 









............................


















Template Conservation   

 




 ............................


  
  

  
  
 
 
Template Sequence  RRAEVAGGGF. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGLTAAIALKQNGWDVRLH
Template Known Secondary structure 


S............................TT
Template Predicted Secondary structure 



............................


Template SS confidence 
























































   12.......20. ........30.........40
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions