Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence53.89%DateThu Jan 5 10:59:52 GMT 2012
Rank88Aligned Residues30
% Identity27%Templatec3ab1B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase; PDBTitle: crystal structure of ferredoxin nadp+ oxidoreductase
Resolution2.39 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50........
Predicted Secondary structure 






















Query SS confidence 

























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  
     
  

                       

   


  
  

  
  
Alig confidence 







............................





















Template Conservation 
 





............................

 


 

  
   
  
 

Template Sequence  MRDLTIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGPTGIFAAFQCGMNNISCRII
Template Known Secondary structure 

............................
STT

Template Predicted Secondary structure 


............................




Template SS confidence 

























































   14.....20. ........30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions