Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence20.73%DateThu Jan 5 10:59:52 GMT 2012
Rank171Aligned Residues29
% Identity24%Templatec2vouA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2,6-dihydroxypyridine hydroxylase; PDBTitle: structure of 2,6-dihydroxypyridine-3-hydroxylase from2 arthrobacter nicotinovorans
Resolution2.6 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50........
Predicted Secondary structure 





















Query SS confidence 
























































Query Sequence  VRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation    
     
  

                       

   


  
  

  
  
Alig confidence 









............................


















Template Conservation   

 




 ............................


  
  


 
  
 

Template Sequence  DRIAVVGGSI. . . . . . . . . . . . . . . . . . . . . . . . . . . . SGLTAALMLRDAGVDVDVY
Template Known Secondary structure  S

S............................TT
Template Predicted Secondary structure 



............................


Template SS confidence 
























































   6...10..... ....20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions