Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence25.48%DateThu Jan 5 10:59:52 GMT 2012
Rank155Aligned Residues34
% Identity32%Templatec2nm0B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:probable 3-oxacyl-(acyl-carrier-protein) reductase; PDBTitle: crystal structure of sco1815: a beta-ketoacyl-acyl carrier protein2 reductase from streptomyces coelicolor a3(2)
Resolution1.99 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 






















Query SS confidence 



























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
Query Conservation 
  
     
  

                       

   


  
  

  
  
  
Alig confidence 









..........................























Template Conservation 
 
 





..........................
 


 
 
  
   

 
 
  
Template Sequence  MSRSVLVTGG. . . . . . . . . . . . . . . . . . . . . . . . . . NRGIGLAIARAFADAGDKVAITYR
Template Known Secondary structure 


T
..........................SSTT
S
Template Predicted Secondary structure 




..........................





Template SS confidence 



























































   1........10 .........20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions