Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence76.19%DateThu Jan 5 10:59:52 GMT 2012
Rank72Aligned Residues30
% Identity27%Templatec2a87A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:thioredoxin reductase; PDBTitle: crystal structure of m. tuberculosis thioredoxin reductase
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50........
Predicted Secondary structure 






















Query SS confidence 

























































Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  
     
  

                       

   


  
  

  
  
Alig confidence 










............................


















Template Conservation 
 








............................


 

  

  
  
 

Template Sequence  VRDVIVIGSGP. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGYTAALYAARAQLAPLVF
Template Known Secondary structure 


............................TT


Template Predicted Secondary structure 





............................


Template SS confidence 

























































   14.....20.... .....30.........40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions