Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence53.62%DateThu Jan 5 10:59:52 GMT 2012
Rank90Aligned Residues30
% Identity23%Templatec1v59B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrolipoamide dehydrogenase; PDBTitle: crystal structure of yeast lipoamide dehydrogenase2 complexed with nad+
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50........
Predicted Secondary structure 

...




















Query SS confidence 


. . .






















































Query Sequence  MVR. . . IYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAI
Query Conservation 
  ...
     
  

                       

   


  
  

  
  
Alig confidence 


...




............................





















Template Conservation 
   






............................

 


 

  
   
  
 

Template Sequence  INKSHDVVIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGPAGYVAAIKAAQLGFNTACV
Template Known Secondary structure 
............................
STT

Template Predicted Secondary structure 



............................




Template SS confidence 




























































   2.......10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions