Return to main results Retrieve Phyre Job Id

Job DescriptionP06999
Confidence31.90%DateThu Jan 5 10:59:52 GMT 2012
Rank128Aligned Residues33
% Identity24%Templatec1ii0A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:arsenical pump-driving atpase; PDBTitle: crystal structure of the escherichia coli arsenite-translocating2 atpase
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40. ........50.........60
Predicted Secondary structure 


















.....



Query SS confidence 








































. . . . .


















Query Sequence  MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGG. . . . . INVARAIAHLGGSATAIFP
Query Conservation 
  
     
  

                       

  ..... 


  
  

  
  
  
Alig confidence 








...........................




.....


















Template Conservation    
    

...........................










 

  

  
 





 
Template Sequence  IPPYLFFTG. . . . . . . . . . . . . . . . . . . . . . . . . . . KGGVGKTSISCATAIRLAEQGKRVLLVST
Template Known Secondary structure 

S
...........................STTSSTT


Template Predicted Secondary structure 


...........................









Template SS confidence 
































































   7..10..... ....20.........30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions