Return to main results Retrieve Phyre Job Id

Job DescriptionP28911
Confidence3.45%DateThu Jan 5 11:45:22 GMT 2012
Rank57Aligned Residues25
% Identity20%Templatec3l9aX_
PDB info PDB header:structural genomics, unknown functionChain: X: PDB Molecule:uncharacterized protein; PDBTitle: structure of the c-terminal domain from a streptococcus2 mutans hypothetical
Resolution1.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   91........100.........110.........120...
Predicted Secondary structure 














Query SS confidence 
































Query Sequence  TSWVVEGTIHSDQIAGGVFIIEIGKNDGRILNF
Query Conservation    


 

       



 
 


 




 
Alig confidence 







..



.





.....






Template Conservation 







..



.





.....






Template Sequence  DFFVITNS. . EYTF. AGVHYA. . . . . KGAVLHV
Template Known Secondary structure 
SS..
.TT
.....TT
Template Predicted Secondary structure 

..
.
.....

Template SS confidence 
































   161....... .170.. ...... .180.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions