Return to main results Retrieve Phyre Job Id

Job DescriptionP31440
Confidence4.46%DateThu Jan 5 11:47:30 GMT 2012
Rank29Aligned Residues24
% Identity21%Templatec2l0kA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:stage iii sporulation protein d; PDBTitle: nmr solution structure of a transcription factor spoiiid in complex2 with dna
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30...
Predicted Secondary structure 
















Query SS confidence 





























Query Sequence  DNTDYVSNESGTLSRLFKLPQHGTTVRTEL
Query Conservation                  
           
 
Alig confidence 







....







..







Template Conservation     



 .... 

 



..







Template Sequence  ETKKTVRV. . . . IAKEFGVS. . KSTVHKDL
Template Known Secondary structure 


....TS
..
Template Predicted Secondary structure 

....


..
Template SS confidence 





























   18.20..... ....30... ......40.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions