Return to main results Retrieve Phyre Job Id

Job DescriptionP77495
Confidence12.18%DateThu Jan 5 12:29:54 GMT 2012
Rank94Aligned Residues49
% Identity22%Templated1i1ga2
SCOP infoFerredoxin-like Dimeric alpha+beta barrel Lrp/AsnC-like transcriptional regulator C-terminal domain
Resolution2.90

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   506...510.........520.........530.........540.........550.........560.........570..
Predicted Secondary structure 

























Query SS confidence 


































































Query Sequence  GTREIEESISSHPGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGN
Query Conservation     


  
   
 
  
 


           
 

                   
   
   
  
Alig confidence 




















.....













.............













Template Conservation      
   
   


     
.....

  
 
  
    .............   
   
   
  
Template Sequence  KLFEVAEKLKEYDFVKELYLS. . . . . SGDHMIMAVIWAKD. . . . . . . . . . . . . GEDLAEIISNKIGK
Template Known Secondary structure  GSTT


.....SSSSSSS.............TTTT
Template Predicted Secondary structure 



.....






.............
Template SS confidence 


































































   76...80.........90...... ...100.........110 .........120....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions