Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence26.06%DateThu Jan 5 12:29:52 GMT 2012
Rank168Aligned Residues29
% Identity21%Templated2ivda1
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD-linked reductases, N-terminal domain
Resolution2.3

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation    

 

   

                         

   
 
  

 

  
  
Alig confidence 







.............................




















Template Conservation 


 



.............................
 


  
  
   
  
 

Template Sequence  MNVAVVGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GISGLAVAHHLRSRGTDAVLL
Template Known Secondary structure 



.............................BTTT

Template Predicted Secondary structure 


.............................



Template SS confidence 

























































   10....... ..20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions