Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence32.44%DateThu Jan 5 12:29:52 GMT 2012
Rank144Aligned Residues30
% Identity23%Templated1ojta1
SCOP infoFAD/NAD(P)-binding domain FAD/NAD(P)-binding domain FAD/NAD-linked reductases, N-terminal and central domains
Resolution2.75

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40.........50.........60.
Predicted Secondary structure 





















Query SS confidence 


























































Query Sequence  NLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation     

 

   

                         

   
 
  

 

  
  
Alig confidence 








.............................




















Template Conservation   







.............................




 

  

  
  
 

Template Sequence  EYDVVVLGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPGGYSAAFAAADEGLKVAIV
Template Known Secondary structure 

.............................STT

Template Predicted Secondary structure 




.............................



Template SS confidence 


























































   122.......130 .........140.........150.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions