Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence59.63%DateThu Jan 5 12:29:52 GMT 2012
Rank90Aligned Residues32
% Identity38%Templatec3rhaA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:putrescine oxidase; PDBTitle: the crystal structure of oxidoreductase from arthrobacter aurescens
Resolution2.05 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50.........60.
Predicted Secondary structure 


..




















Query SS confidence 


. .

























































Query Sequence  MDN. . LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
  ..  

 

   

                         

   
 
  

 

  
  
Alig confidence 


..







.............................




















Template Conservation 
     






.............................
 





  
   
  
 

Template Sequence  MQNLDRDVVIVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPSGLTAARELKKAGLSVAVL
Template Known Secondary structure 

S

.............................STT

Template Predicted Secondary structure 








.............................



Template SS confidence 






























































   3......10..... ....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions