Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence45.92%DateThu Jan 5 12:29:52 GMT 2012
Rank111Aligned Residues32
% Identity19%Templatec3lzxB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:ferredoxin--nadp reductase 2; PDBTitle: crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus2 subtilis (form ii)
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1... .....10.........20.........30.........40.........50.........60.
Predicted Secondary structure 



....



















Query SS confidence 



. . . .
























































Query Sequence  MDNL. . . . DVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
   .... 

 

   

                         

   
 
  

 

  
  
Alig confidence 



....






.............................




















Template Conservation 
      







.............................




 

  
   
  
 

Template Sequence  MREDTKVYDITIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPVGLFTAFYGGMRQASVKII
Template Known Secondary structure 


.............................STT

Template Predicted Secondary structure 






.............................




Template SS confidence 
































































   1........10..... ....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions