Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence68.29%DateThu Jan 5 12:29:52 GMT 2012
Rank80Aligned Residues32
% Identity25%Templatec3i3lA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:alkylhalidase cmls; PDBTitle: crystal structure of cmls, a flavin-dependent halogenase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.
Predicted Secondary structure 























Query SS confidence 




























































Query Sequence  MDNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
    

 

   

                         

   
 
  

 

  
  
Alig confidence 










.............................




















Template Conservation 
   






.............................




 

  


 

 
 

Template Sequence  MTRSKVAIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGSVAGLTLHKLGHDVTIY
Template Known Secondary structure 





.............................STT
Template Predicted Secondary structure 





.............................



Template SS confidence 




























































   1........10. ........20.........30..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions