Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence40.15%DateThu Jan 5 12:29:52 GMT 2012
Rank123Aligned Residues32
% Identity38%Templatec3cesB_
PDB info PDB header:rna binding proteinChain: B: PDB Molecule:trna uridine 5-carboxymethylaminomethyl modification enzyme PDBTitle: crystal structure of e.coli mnmg (gida), a highly-conserved trna2 modifying enzyme
Resolution2.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60..
Predicted Secondary structure 






















Query SS confidence 




























































Query Sequence  DNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALMS
Query Conservation      

 

   

                         

   
 
  

 

  
  
 
Alig confidence 









.............................





















Template Conservation    







.............................
 


 

  


 
 





Template Sequence  DPFDVIIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GHAGTEAAMAAARMGQQTLLLT
Template Known Secondary structure  S

S

.............................STT

Template Predicted Secondary structure 



.............................




Template SS confidence 




























































   5....10.... .....20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions