Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence63.86%DateThu Jan 5 12:29:52 GMT 2012
Rank85Aligned Residues32
% Identity38%Templatec3atrA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:conserved archaeal protein; PDBTitle: geranylgeranyl reductase (ggr) from sulfolobus acidocaldarius co-2 crystallized with its ligand
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.... ....10.........20.........30.........40.........50.........60.
Predicted Secondary structure 



..



















Query SS confidence 




. .























































Query Sequence  MDNLD. . VICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
    ..

 

   

                         

   
 
  

 

  
  
Alig confidence 




..





.............................




















Template Conservation 
    







.............................
 


 

  

  
  
 

Template Sequence  MKELKYDVLIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GFAGSSAAYQLSRRGLKILLV
Template Known Secondary structure 

S

.............................SSSSS

Template Predicted Secondary structure 






.............................



Template SS confidence 






























































   1........10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions