Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence25.04%DateThu Jan 5 12:29:52 GMT 2012
Rank172Aligned Residues31
% Identity23%Templatec2w0hA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:trypanothione reductase; PDBTitle: x ray structure of leishmania infantum trypanothione2 reductase in complex with antimony and nadph
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.. .......60.
Predicted Secondary structure 


















.



Query SS confidence 


















































.








Query Sequence  DNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIIS. RLGHRTALM
Query Conservation      

 

   

                         

   
 
  

. 

  
  
Alig confidence 









.............................











.








Template Conservation 
 







.............................
 


 

  

   
  
 

Template Sequence  RAYDLVVLGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GSGGLEAGWNAAVTHKKKVAVV
Template Known Secondary structure 
S

.............................STS


Template Predicted Secondary structure 


.............................



Template SS confidence 




























































   3......10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions