Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence25.97%DateThu Jan 5 12:29:52 GMT 2012
Rank169Aligned Residues32
% Identity22%Templatec2gr2A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:ferredoxin reductase; PDBTitle: crystal structure of ferredoxin reductase, bpha4 (oxidized form)
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50....... ..60..
Predicted Secondary structure 























..
Query SS confidence 
























































. .




Query Sequence  MDNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHR. . TALMS
Query Conservation 
    

 

   

                         

   
 
  

 

  ..
  
 
Alig confidence 


.






.............................
















..




Template Conservation 

 . 





.............................
 


 

  
   
    
 


Template Sequence  LKA. PVVVLGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GLASVSFVAELRQAGYQGLITVVG
Template Known Secondary structure 

S.S

.............................ST

S
Template Predicted Secondary structure 


.


.............................





Template SS confidence 































































   6.. .10..... ....20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions