Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence38.10%DateThu Jan 5 12:29:52 GMT 2012
Rank127Aligned Residues32
% Identity38%Templatec2gmhA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:electron transfer flavoprotein-ubiquinone PDBTitle: structure of porcine electron transfer flavoprotein-2 ubiquinone oxidoreductase in complexed with ubiquinone
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.... .....60.
Predicted Secondary structure 




















......


Query SS confidence 





















































. . . . . .






Query Sequence  MDNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRL. . . . . . GHRTALM
Query Conservation 
    

 

   

                         

   
 
  

 
......
  
  
Alig confidence 










.............................













......






Template Conservation      






.............................







  


       
  
 

Template Sequence  AEEADVVIVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGLSAATRLKQLAAQHEKDLRVCLV
Template Known Secondary structure 
S

.............................STT



Template Predicted Secondary structure 






.............................






Template SS confidence 


































































   33......40... ......50.........60.........70
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions