Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence26.61%DateThu Jan 5 12:29:52 GMT 2012
Rank163Aligned Residues29
% Identity10%Templatec2cduB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:nadph oxidase; PDBTitle: the crystal structure of water-forming nad(p)h oxidase from2 lactobacillus sanfranciscensis
Resolution1.8 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.... .....60.
Predicted Secondary structure 

















..


Query SS confidence 


















































. .






Query Sequence  LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRL. . GHRTALM
Query Conservation    

 

   

                         

   
 
  

 
..
  
  
Alig confidence 







.............................













..






Template Conservation 







.............................
 


 

  
     
  
 

Template Sequence  MKVIVVGC. . . . . . . . . . . . . . . . . . . . . . . . . . . . . THAGTFAVKQTIADHPDADVTAY
Template Known Secondary structure 


.............................S
TT
Template Predicted Secondary structure 


.............................




Template SS confidence 



























































   1....... .10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions