Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence45.78%DateThu Jan 5 12:29:52 GMT 2012
Rank113Aligned Residues32
% Identity25%Templatec2bs3A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:quinol-fumarate reductase flavoprotein subunit a; PDBTitle: glu c180 -> gln variant quinol:fumarate reductase from2 wolinella succinogenes
Resolution2.19 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1... .....10.........20.........30.........40.........50.........60.
Predicted Secondary structure 



..



















Query SS confidence 



. .
























































Query Sequence  MDNL. . DVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
   .. 

 

   

                         

   
 
  

 

  
  
Alig confidence 



..






.............................




















Template Conservation 
     






.............................
 


 


 


 
 

 

Template Sequence  MKVQYCDSLVIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GLAGLRAAVATQQKGLSTIVL
Template Known Secondary structure 


S

.............................STTT

Template Predicted Secondary structure 



.............................




Template SS confidence 






























































   1........10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions