Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence49.61%DateThu Jan 5 12:29:52 GMT 2012
Rank107Aligned Residues33
% Identity36%Templatec1yq4A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:succinate dehydrogenase flavoprotein subunit; PDBTitle: avian respiratory complex ii with 3-nitropropionate and ubiquinone
Resolution2.33 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60...
Predicted Secondary structure 






















Query SS confidence 





























































Query Sequence  DNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALMSR
Query Conservation      

 

   

                         

   
 
  

 

  
  
  
Alig confidence 









.............................






















Template Conservation   
 






.............................
 


 

  


 
  
 



Template Sequence  HEFDAVVVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GGAGLRAAFGLSEAGFNTACVTK
Template Known Secondary structure 
S

.............................STT

S
Template Predicted Secondary structure 





.............................




Template SS confidence 





























































   17..20...... ...30.........40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions