Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence64.89%DateThu Jan 5 12:29:52 GMT 2012
Rank83Aligned Residues32
% Identity31%Templatec1v59B_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:dihydrolipoamide dehydrogenase; PDBTitle: crystal structure of yeast lipoamide dehydrogenase2 complexed with nad+
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1.. ......10.........20.........30.........40.........50.........60.
Predicted Secondary structure 


.




















Query SS confidence 


.

























































Query Sequence  MDN. LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
  .  

 

   

                         

   
 
  

 

  
  
Alig confidence 


.







.............................




















Template Conservation 
   







.............................
 


 

  
   
  
 

Template Sequence  INKSHDVVIIGG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGYVAAIKAAQLGFNTACV
Template Known Secondary structure 

.............................STT

Template Predicted Secondary structure 




.............................



Template SS confidence 





























































   2.......10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions