Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence29.12%DateThu Jan 5 12:29:52 GMT 2012
Rank154Aligned Residues32
% Identity34%Templatec1tytA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:trypanothione reductase, oxidized form; PDBTitle: crystal and molecular structure of crithidia fasciculata2 trypanothione reductase at 2.6 angstroms resolution
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40.........50..... ....60.
Predicted Secondary structure 

.



















.

Query SS confidence 

.




















































.





Query Sequence  MD. NLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLG. HRTALM
Query Conservation 
 .   

 

   

                         

   
 
  

 

.  
  
Alig confidence 

.








.............................














.





Template Conservation 


 







.............................
 


 

  

  
   
 

Template Sequence  MSRAYDLVVIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GSGGLEAGWNAASLHKKRVAVI
Template Known Secondary structure 

SS

.............................S


Template Predicted Secondary structure 





.............................





Template SS confidence 






























































   1........10.. .......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions