Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence24.61%DateThu Jan 5 12:29:52 GMT 2012
Rank175Aligned Residues31
% Identity29%Templatec1phhA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:p-hydroxybenzoate hydroxylase; PDBTitle: crystal structure of p-hydroxybenzoate hydroxylase complexed with its2 reaction product 3,4-dihydroxybenzoate
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60.
Predicted Secondary structure 























Query SS confidence 




























































Query Sequence  MDNLDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation 
    

 

   

                         

   
 
  

 

  
  
Alig confidence 


.






.............................




















Template Conservation 
  .

 



.............................
 


  
  
   
  
 
 
Template Sequence  MKT. QVAIIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPSGLLLGQLLHKAGIDNVIL
Template Known Secondary structure 
B
.S

.............................ST

Template Predicted Secondary structure 


.


.............................



Template SS confidence 




























































   1.. ......10 .........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions