Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence22.16%DateThu Jan 5 12:29:52 GMT 2012
Rank182Aligned Residues29
% Identity21%Templatec1nhqA_
PDB info PDB header:oxidoreductase (h2o2(a))Chain: A: PDB Molecule:nadh peroxidase; PDBTitle: crystallographic analyses of nadh peroxidase cys42ala and cys42ser2 mutants: active site structure, mechanistic implications, and an3 unusual environment of arg303
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.... .....60.
Predicted Secondary structure 

















..


Query SS confidence 


















































. .






Query Sequence  LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRL. . GHRTALM
Query Conservation    

 

   

                         

   
 
  

 
..
  
  
Alig confidence 







.............................













..






Template Conservation 







.............................
 


 

  
        
 

Template Sequence  MKVIVLGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . SHGGYEAVEELLNLHPDAEIQWY
Template Known Secondary structure 

S.............................S
TTS
Template Predicted Secondary structure 


.............................




Template SS confidence 



























































   1....... .10.........20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions