Return to main results Retrieve Phyre Job Id

Job DescriptionP77493
Confidence32.10%DateThu Jan 5 12:29:52 GMT 2012
Rank145Aligned Residues29
% Identity45%Templatec1fl2A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:alkyl hydroperoxide reductase subunit f; PDBTitle: catalytic core component of the alkylhydroperoxide reductase ahpf from2 e.coli
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60.
Predicted Secondary structure 




















Query SS confidence 

























































Query Sequence  LDVICIGAAIVDIPLQPVSKNIFDVDSYPLERIAMTTGGDAINEATIISRLGHRTALM
Query Conservation    

 

   

                         

   
 
  

 

  
  
Alig confidence 







.............................




















Template Conservation 







.............................




 

  
   
  
 

Template Sequence  YDVLIVGS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGAAAAIYSARKGIRTGLM
Template Known Secondary structure 

.............................STTT

Template Predicted Secondary structure 



.............................



Template SS confidence 

























































   213......220 .........230.........240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions