Return to main results Retrieve Phyre Job Id

Job DescriptionP07021
Confidence4.76%DateThu Jan 5 11:00:04 GMT 2012
Rank71Aligned Residues39
% Identity26%Templatec3l7pA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:putative nitrogen regulatory protein pii; PDBTitle: crystal structure of smu.1657c, putative nitrogen regulatory protein2 pii from streptococcus mutans
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   108.110.........120 .........130.........140.........150.........160
Predicted Secondary structure 

.



















Query SS confidence 












.







































Query Sequence  RANVVADAWAMGG. QIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP
Query Conservation 

  
   
   
.      
   
 
   
            





 
  
Alig confidence 












.
















..............








Template Conservation 
   
  

   
 
 
 

  
 
 
    ..............







 
Template Sequence  KLEDLKAALVQSGFIKGMTISQVLGFGTLLA. . . . . . . . . . . . . . KVKVEIVAH
Template Known Secondary structure  GT
GGG

..............
Template Predicted Secondary structure 








..............
Template SS confidence 





















































   12.......20.........30.........40.. .......50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions