Return to main results Retrieve Phyre Job Id

Job DescriptionP07021
Confidence7.20%DateThu Jan 5 11:00:04 GMT 2012
Rank56Aligned Residues40
% Identity15%Templatec3bzqA_
PDB info PDB header:signaling protein/transcriptionChain: A: PDB Molecule:nitrogen regulatory protein p-ii; PDBTitle: high resolution crystal structure of nitrogen regulatory protein2 (rv2919c) of mycobacterium tuberculosis
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   108.110.........120.........130.........140.........150.........160
Predicted Secondary structure 





















Query SS confidence 




















































Query Sequence  RANVVADAWAMGGQIPRSNLTTQGLGKKYPIASNKTAQGRAENRRVAVVITTP
Query Conservation 

  
   
   
      
   
 
   
            





 
  
Alig confidence 



























.............











Template Conservation      
  

   
  
 

  
 
 
  .............   
  
 


 
Template Sequence  TLDDVKTSLEDAGVLGMTVSEIQGYGRD. . . . . . . . . . . . . FVPKVRIEVVVD
Template Known Secondary structure  GTT






.............
Template Predicted Secondary structure 






.............



Template SS confidence 




















































   12.......20.........30......... 40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions