Return to main results Retrieve Phyre Job Id

Job DescriptionP62620
Confidence47.08%DateThu Jan 5 12:07:43 GMT 2012
Rank419Aligned Residues35
% Identity46%Templatec1c4cA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:protein (fe-only hydrogenase); PDBTitle: binding of exogenously added carbon monoxide at the active2 site of the fe-only hydrogenase (cpi) from clostridium3 pasteurianum
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   248.250.........260........ .270.........280.........290.........300.........310....
Predicted Secondary structure 








...





















Query SS confidence 




















. . .













































Query Sequence  IKVGFDILKSLRIRSRGINFI. . . ACPTCSRQEFDVIGTVNALEQRLEDIITPMDVSIIGCVVNGPGEAL
Query Conservation 
     

 
 


      
...






 
 

   
  
  

  
   















 
Alig confidence 




















...



...............................


.






Template Conservation    

   
  

 
     








...............................


.




  
Template Sequence  ASNLFKFMKSGMINEKQYHFIEVMACHG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GCV. NGGGQPH
Template Known Secondary structure  TTGGGSS

SSSTT...............................SGG.G
TTS

Template Predicted Secondary structure 










...............................


.






Template SS confidence 





































































   474.....480.........490.........500. ... .....510.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions