Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB85
Confidence10.39%DateThu Jan 5 11:14:52 GMT 2012
Rank38Aligned Residues23
% Identity30%Templatec2an1D_
PDB info PDB header:transferaseChain: D: PDB Molecule:putative kinase; PDBTitle: structural genomics, the crystal structure of a putative kinase from2 salmonella typhimurim lt2
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   192.......200..... ....210....
Predicted Secondary structure 



..................


Query SS confidence 













. . . . . . . . . . . . . . . . . .








Query Sequence  ADHLARLMEQEGIS. . . . . . . . . . . . . . . . . . RYLVSVGGA
Query Conservation 

     
   

 ..................  

  


Alig confidence 













..................








Template Conservation     
   
   

 
 
               



 



Template Sequence  HEMLYRWLCDQGYEVIVEKVPTGTLAEIGQQADLAVVVGGD
Template Known Secondary structure  TT




B


SS
Template Predicted Secondary structure 
















Template SS confidence 








































   23......30.........40.........50.........60...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions