Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEV4
Confidence13.10%DateThu Jan 5 11:24:20 GMT 2012
Rank10Aligned Residues18
% Identity39%Templatec3udiA_
PDB info PDB header:penicillin-binding protein/antibioticChain: A: PDB Molecule:penicillin-binding protein 1a; PDBTitle: crystal structure of acinetobacter baumannii pbp1a in complex with2 penicillin g
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72.......80.........90.........100.........110.........120...
Predicted Secondary structure 



















Query SS confidence 



















































Query Sequence  FNSHTIEYYVETKDGEDKQRIAQAQLSIDGMIDGKVNIRDREQVLEHYLEKI
Query Conservation 


 

 
 
   

      
 
 

  
 


 
 



  





 

Alig confidence 



..................................













Template Conservation 

 
.................................. 

 



 


 
Template Sequence  FFQN. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . LSKEDILSLYVNKI
Template Known Secondary structure 



..................................TTT
Template Predicted Secondary structure  ..................................





Template SS confidence 



















































   71... .....80........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions