Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9G6
Confidence53.07%DateThu Jan 5 11:10:09 GMT 2012
Rank151Aligned Residues49
% Identity29%Templatec3ktsA_
PDB info PDB header:transcriptional regulatorChain: A: PDB Molecule:glycerol uptake operon antiterminator regulatory protein; PDBTitle: crystal structure of glycerol uptake operon antiterminator regulatory2 protein from listeria monocytogenes str. 4b f2365
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   117..120.........130.........140.........150.........160.........170.........180.........190...
Predicted Secondary structure 


































Query SS confidence 












































































Query Sequence  VPAVVERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGAAAVHFEDQLASVK
Query Conservation 
   
  
  
    

 
             
  









 
   

 



    



 





    
Alig confidence 












......................




......






























Template Conservation   
  
  
     ...................... 



......



   


  

 


 




   

  
Template Sequence  IPEQVQKMTQKLH. . . . . . . . . . . . . . . . . . . . . . IPVIA. . . . . . GGLIETSEQVNQVIASGAIAVTTSNKHLWEG
Template Known Secondary structure 

......................

......SS

STTT

GGGGTT
Template Predicted Secondary structure 

......................

......










Template SS confidence 












































































   136...140........ .150... ......160.........170.........180....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions