Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7W1
Confidence7.54%DateThu Jan 5 11:06:20 GMT 2012
Rank90Aligned Residues34
% Identity12%Templatec2vxaL_
PDB info PDB header:flavoproteinChain: L: PDB Molecule:dodecin; PDBTitle: h.halophila dodecin in complex with riboflavin
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   33......40.........50.........60.........70......
Predicted Secondary structure 







Query SS confidence 











































Query Sequence  FTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMINVAL
Query Conservation 
 






  
 

 
 


 

  

 

   
  


 
  
Alig confidence 









..........























Template Conservation   






 
..........  
 



  

  
 


  
  
Template Sequence  YKIVELTGSS. . . . . . . . . . PNGIEEAVNNAIARAGETLRHLRW
Template Known Secondary structure  ..........SS



Template Predicted Secondary structure 
..........





Template SS confidence 











































   6...10..... ....20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions